![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily) duplication; dimetal(zinc)-bound fold with little secondary structure |
![]() | Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) ![]() Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137) |
![]() | Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins) |
![]() | Protein automated matches [267684] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [267978] (1 PDB entry) |
![]() | Domain d4nw3a_: 4nw3 A: [266988] automated match to d2j2sa_ protein/DNA complex; complexed with zn |
PDB Entry: 4nw3 (more details), 2.82 Å
SCOPe Domain Sequences for d4nw3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nw3a_ g.95.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrsrrcgqcpgcqvpedcgvctncldkpkfggrnikkqcckmrkcqnlqwm
Timeline for d4nw3a_: