Lineage for d4nw3a_ (4nw3 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038986Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily)
    duplication; dimetal(zinc)-bound fold with little secondary structure
  4. 3038987Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) (S)
    Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137)
  5. 3038988Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins)
  6. 3038999Protein automated matches [267684] (1 species)
    not a true protein
  7. 3039000Species Human (Homo sapiens) [TaxId:9606] [267978] (1 PDB entry)
  8. 3039001Domain d4nw3a_: 4nw3 A: [266988]
    automated match to d2j2sa_
    protein/DNA complex; complexed with zn

Details for d4nw3a_

PDB Entry: 4nw3 (more details), 2.82 Å

PDB Description: crystal structure of mll cxxc domain in complex with a cpg dna
PDB Compounds: (A:) Histone-lysine N-methyltransferase 2A

SCOPe Domain Sequences for d4nw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nw3a_ g.95.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrsrrcgqcpgcqvpedcgvctncldkpkfggrnikkqcckmrkcqnlqwm

SCOPe Domain Coordinates for d4nw3a_:

Click to download the PDB-style file with coordinates for d4nw3a_.
(The format of our PDB-style files is described here.)

Timeline for d4nw3a_: