![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
![]() | Protein automated matches [227009] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries) |
![]() | Domain d4ntmd_: 4ntm D: [266985] automated match to d4ntka_ complexed with 2k8, zn |
PDB Entry: 4ntm (more details), 2.05 Å
SCOPe Domain Sequences for d4ntmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntmd_ d.96.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]} msttlfkdftfeaahrlphvpeghkcgrlhghsfmvrleitgevdphtgwiidfaelkaa fkptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrge
Timeline for d4ntmd_: