Lineage for d4nrva3 (4nrv A:247-290)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640848Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2640849Protein automated matches [190463] (9 species)
    not a true protein
  7. 2640881Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)
  8. 2640899Domain d4nrva3: 4nrv A:247-290 [266981]
    Other proteins in same PDB: d4nrva1, d4nrva2
    automated match to d1tdha3
    complexed with trs

Details for d4nrva3

PDB Entry: 4nrv (more details), 2.6 Å

PDB Description: Crystal Structure of non-edited human NEIL1
PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d4nrva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrva3 g.39.1.0 (A:247-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap

SCOPe Domain Coordinates for d4nrva3:

Click to download the PDB-style file with coordinates for d4nrva3.
(The format of our PDB-style files is described here.)

Timeline for d4nrva3: