![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
![]() | Domain d4nrva3: 4nrv A:247-290 [266981] Other proteins in same PDB: d4nrva1, d4nrva2 automated match to d1tdha3 complexed with trs |
PDB Entry: 4nrv (more details), 2.6 Å
SCOPe Domain Sequences for d4nrva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nrva3 g.39.1.0 (A:247-290) automated matches {Human (Homo sapiens) [TaxId: 9606]} esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap
Timeline for d4nrva3: