SCOPe 2.05: Domain d4nrva2: 4nrv A:132-246

Lineage for d4nrva2 (4nrv A:132-246)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.0: automated matches [254300] (1 protein)
   not a true family

6. Protein automated matches [254693] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267977] (1 PDB entry)

8. Domain d4nrva2: 4nrv A:132-246 [266980]
   Other proteins in same PDB: d4nrva1, d4nrva3
   automated match to d1tdha1
   complexed with trs

Details for d4nrva2

PDB Entry: 4nrv, 2.6 Å

PDB Description: Crystal Structure of non-edited human NEIL1

PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d4nrva2:

Sequence, based on SEQRES records:

>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggkgygs

Sequence, based on observed residues (ATOM records):

>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqeltlsqkirtklqnpdllelchsvpkevvqlggkgygs

Timeline for d4nrva2:

• d4nrva2 is new in SCOPe 2.05-stable
  
• d4nrva2 appears in SCOPe 2.06
  
• d4nrva2 appears in the current release, SCOPe 2.08