Class a: All alpha proteins [46456] (286 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.0: automated matches [254300] (1 protein) not a true family |
Protein automated matches [254693] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [267977] (1 PDB entry) |
Domain d4nrva2: 4nrv A:132-246 [266980] Other proteins in same PDB: d4nrva1, d4nrva3 automated match to d1tdha1 complexed with trs |
PDB Entry: 4nrv (more details), 2.6 Å
SCOPe Domain Sequences for d4nrva2:
Sequence, based on SEQRES records: (download)
>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggkgygs
>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqeltlsqkirtklqnpdllelchsvpkevvqlggkgygs
Timeline for d4nrva2: