Lineage for d4nrva2 (4nrv A:132-246)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735452Family a.156.1.0: automated matches [254300] (1 protein)
    not a true family
  6. 2735453Protein automated matches [254693] (4 species)
    not a true protein
  7. 2735456Species Human (Homo sapiens) [TaxId:9606] [267977] (2 PDB entries)
  8. 2735458Domain d4nrva2: 4nrv A:132-246 [266980]
    Other proteins in same PDB: d4nrva1, d4nrva3
    automated match to d1tdha1
    complexed with trs

Details for d4nrva2

PDB Entry: 4nrv (more details), 2.6 Å

PDB Description: Crystal Structure of non-edited human NEIL1
PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d4nrva2:

Sequence, based on SEQRES records: (download)

>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggkgygs

Sequence, based on observed residues (ATOM records): (download)

>d4nrva2 a.156.1.0 (A:132-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqeltlsqkirtklqnpdllelchsvpkevvqlggkgygs

SCOPe Domain Coordinates for d4nrva2:

Click to download the PDB-style file with coordinates for d4nrva2.
(The format of our PDB-style files is described here.)

Timeline for d4nrva2: