SCOPe 2.05: Domain d4nrva1: 4nrv A:2-131

Lineage for d4nrva1 (4nrv A:2-131)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein automated matches [254692] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267976] (1 PDB entry)

8. Domain d4nrva1: 4nrv A:2-131 [266979]
   Other proteins in same PDB: d4nrva2, d4nrva3
   automated match to d1tdha2
   complexed with trs

Details for d4nrva1

PDB Entry: 4nrv, 2.6 Å

PDB Description: Crystal Structure of non-edited human NEIL1

PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d4nrva1:

Sequence; same for both SEQRES and ATOM records:

>d4nrva1 b.113.1.1 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
rwdlggkwqp

Timeline for d4nrva1:

• d4nrva1 is new in SCOPe 2.05-stable
  
• d4nrva1 appears in SCOPe 2.06
  
• d4nrva1 appears in the current release, SCOPe 2.08