Lineage for d4nr0a_ (4nr0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451704Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [261223] (2 PDB entries)
  8. 2451705Domain d4nr0a_: 4nr0 A: [266973]
    automated match to d4nqza_
    complexed with nad, tcl

Details for d4nr0a_

PDB Entry: 4nr0 (more details), 1.8 Å

PDB Description: crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI

SCOPe Domain Sequences for d4nr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nr0a_ c.2.1.2 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
gisgeilyvdggfnttamg

SCOPe Domain Coordinates for d4nr0a_:

Click to download the PDB-style file with coordinates for d4nr0a_.
(The format of our PDB-style files is described here.)

Timeline for d4nr0a_: