SCOPe 2.08: Domain d4nqve2: 4nqv E:182-274

Lineage for d4nqve2 (4nqv E:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4nqve2: 4nqv E:182-274 [266972]
   Other proteins in same PDB: d4nqve1
   automated match to d1x7qa1

Details for d4nqve2

PDB Entry: 4nqv, 2.39 Å

PDB Description: Crystal Structure of HLA A*0101 in complex with NP44, an 9-mer influenza epitope

PDB Compounds: (E:) HLA class I histocompatibility antigen, A-1 alpha chain

SCOPe Domain Sequences for d4nqve2:

Sequence; same for both SEQRES and ATOM records:

>d4nqve2 b.1.1.0 (E:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrw

Timeline for d4nqve2:

• d4nqve2 first appeared in SCOPe 2.05
  
• d4nqve2 appears in SCOPe 2.07