SCOPe 2.08: Domain d4nq8b1: 4nq8 B:25-324

Lineage for d4nq8b1 (4nq8 B:25-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [267969] (3 PDB entries)

8. Domain d4nq8b1: 4nq8 B:25-324 [266970]
   Other proteins in same PDB: d4nq8a2, d4nq8b2
   automated match to d4p47a_
   complexed with cl, paf, so4

Details for d4nq8b1

PDB Entry: 4nq8, 1.5 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from Bordetella bronchispeptica (bb3421), target EFI-510039, with density modeled as pantoate

PDB Compounds: (B:) Putative periplasmic substrate-binding transport protein

SCOPe Domain Sequences for d4nq8b1:

Sequence; same for both SEQRES and ATOM records:

>d4nq8b1 c.94.1.0 (B:25-324) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
qttlkmayalstsshygagaeafaksiegasggkykvqqfansalggerevieglqigti
dlaivstgatlnfvpetgvfdipfllrdlpharavldskigqdmlakfpdrgiialawge
qgfrhltnnvrpvktpadakglkirttenpihitafrqigilptpmawpevatalqqgti
dgqenplsvitsaklsqlqkylsltghvygpalvlmsanvynglsdaekasfkaagkdsa
qamrayvdnieqtgveqlkkegmevsevdraafaaavepayaeyykkfdkqliqsirdtk

Timeline for d4nq8b1:

• d4nq8b1 first appeared in SCOPe 2.05, called d4nq8b_
  
• d4nq8b1 appears in SCOPe 2.07