| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Bordetella bronchiseptica [TaxId:257310] [267969] (3 PDB entries) |
| Domain d4nq8b1: 4nq8 B:25-324 [266970] Other proteins in same PDB: d4nq8a2, d4nq8b2 automated match to d4p47a_ complexed with cl, paf, so4 |
PDB Entry: 4nq8 (more details), 1.5 Å
SCOPe Domain Sequences for d4nq8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nq8b1 c.94.1.0 (B:25-324) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
qttlkmayalstsshygagaeafaksiegasggkykvqqfansalggerevieglqigti
dlaivstgatlnfvpetgvfdipfllrdlpharavldskigqdmlakfpdrgiialawge
qgfrhltnnvrpvktpadakglkirttenpihitafrqigilptpmawpevatalqqgti
dgqenplsvitsaklsqlqkylsltghvygpalvlmsanvynglsdaekasfkaagkdsa
qamrayvdnieqtgveqlkkegmevsevdraafaaavepayaeyykkfdkqliqsirdtk
Timeline for d4nq8b1: