Lineage for d4nq6a_ (4nq6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937687Species Bacillus cereus [TaxId:1396] [56284] (23 PDB entries)
    Uniprot P04190 31-257
  8. 1937709Domain d4nq6a_: 4nq6 A: [266967]
    automated match to d2m5ca_
    complexed with 3r9, k, zn

Details for d4nq6a_

PDB Entry: 4nq6 (more details), 1.8 Å

PDB Description: bacillus cereus zn-dependent metallo-beta-lactamase at ph 7 complexed with compound l-cs319
PDB Compounds: (A:) Beta-lactamase 2

SCOPe Domain Sequences for d4nq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nq6a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d4nq6a_:

Click to download the PDB-style file with coordinates for d4nq6a_.
(The format of our PDB-style files is described here.)

Timeline for d4nq6a_: