Lineage for d1c6xa_ (1c6x A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796358Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1797195Domain d1c6xa_: 1c6x A: [26694]
    complexed with 3in

Details for d1c6xa_

PDB Entry: 1c6x (more details), 2.5 Å

PDB Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.
PDB Compounds: (A:) protein (protease)

SCOPe Domain Sequences for d1c6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6xa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

SCOPe Domain Coordinates for d1c6xa_:

Click to download the PDB-style file with coordinates for d1c6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1c6xa_: