Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Desulfovibrio desulfuricans [TaxId:525146] [267975] (1 PDB entry) |
Domain d4nhbb1: 4nhb B:29-335 [266930] Other proteins in same PDB: d4nhbb2 automated match to d4p47a_ complexed with g3p, iod |
PDB Entry: 4nhb (more details), 1.9 Å
SCOPe Domain Sequences for d4nhbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhbb1 c.94.1.0 (B:29-335) automated matches {Desulfovibrio desulfuricans [TaxId: 525146]} tvikmagmkpegepetigmhlfgkylkelsngkyevqvfpnsqlgkedayiaatrkgiiq mcatgtqtsalhpamamletpmlfdnldharramegktfdlinegfteksglrtlnafpl gfrhfyskkpikdvkdlegmrmrvpniplytnfakecgisgqpmpfaevpgaldqgvidg gdspladivslkmyeitpeislsghilvihslyindkffkslpeqdqkwieeaakrsadd vwamvadgdekakatilankgnihepskelhehlvnagkrswklfydtvpnaqaildsad syresk
Timeline for d4nhbb1: