SCOPe 2.07: Domain d4nhbb1: 4nhb B:29-335

Lineage for d4nhbb1 (4nhb B:29-335)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [TaxId:525146] [267975] (1 PDB entry)

8. Domain d4nhbb1: 4nhb B:29-335 [266930]
   Other proteins in same PDB: d4nhbb2
   automated match to d4p47a_
   complexed with g3p, iod

Details for d4nhbb1

PDB Entry: 4nhb, 1.9 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio desulfuricans (ddes_1525), target efi-510107, with bound sn-glycerol-3-phosphate

PDB Compounds: (B:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4nhbb1:

Sequence; same for both SEQRES and ATOM records:

>d4nhbb1 c.94.1.0 (B:29-335) automated matches {Desulfovibrio desulfuricans [TaxId: 525146]}
tvikmagmkpegepetigmhlfgkylkelsngkyevqvfpnsqlgkedayiaatrkgiiq
mcatgtqtsalhpamamletpmlfdnldharramegktfdlinegfteksglrtlnafpl
gfrhfyskkpikdvkdlegmrmrvpniplytnfakecgisgqpmpfaevpgaldqgvidg
gdspladivslkmyeitpeislsghilvihslyindkffkslpeqdqkwieeaakrsadd
vwamvadgdekakatilankgnihepskelhehlvnagkrswklfydtvpnaqaildsad
syresk

Timeline for d4nhbb1:

• d4nhbb1 first appeared in SCOPe 2.05, called d4nhbb_
  
• d4nhbb1 appears in SCOPe 2.06
  
• d4nhbb1 appears in the current release, SCOPe 2.08