![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Citrobacter koseri [TaxId:290338] [267974] (2 PDB entries) |
![]() | Domain d4ng7a1: 4ng7 A:30-327 [266928] Other proteins in same PDB: d4ng7a2 automated match to d4mcoc_ |
PDB Entry: 4ng7 (more details), 2.3 Å
SCOPe Domain Sequences for d4ng7a1:
Sequence, based on SEQRES records: (download)
>d4ng7a1 c.94.1.0 (A:30-327) automated matches {Citrobacter koseri [TaxId: 290338]} ikaadvhpqgypnvvavqkmgeklkqqtdgkleikvfpggvlgdekqmieqaqigaidmi rvsmapvaailpdievftlpyvfrdedhmhkiidgdigksigdkltnnpksrlvflgwmd sgtrnlitknpvekpedlhgmkirvqgspvaldtlkdmgansvamgvsevfsgmqtgvid gaennpptfvahnympvaknytlsghfitpemllyskvkwdkltadeqqkiltlareaqf eqrklwdaynqealakmkaggvqfheidkayfvkatepvraqygekhqalmkaiadvq
>d4ng7a1 c.94.1.0 (A:30-327) automated matches {Citrobacter koseri [TaxId: 290338]} ikaadvhpqgypnvvavqkmgeklkqqleikvfpggvlgdekqmieqaqigaidmirvsm apvaailpdievftlpyvfrdedhmhkiidgdigksigdkltrlvflgwmdsgtrnlitk npvekpedlhgmkirvqgspvaldtlkdmgansvamgvsevfsgmqtgvidgaennpptf vahnympvaknytlsghfitpemllyskvkwdkltadeqqkiltlareaqfeqrklwday nqealakmkaggvqfheidkayfvkatepvraqyhqalmkaiadvq
Timeline for d4ng7a1: