Lineage for d4nfxh_ (4nfx H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971838Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries)
  8. 2971870Domain d4nfxh_: 4nfx H: [266927]
    automated match to d3dkua_

Details for d4nfxh_

PDB Entry: 4nfx (more details), 2.69 Å

PDB Description: structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli
PDB Compounds: (H:) Putative Nudix hydrolase ymfB

SCOPe Domain Sequences for d4nfxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfxh_ d.113.1.0 (H:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfn

SCOPe Domain Coordinates for d4nfxh_:

Click to download the PDB-style file with coordinates for d4nfxh_.
(The format of our PDB-style files is described here.)

Timeline for d4nfxh_: