SCOPe 2.06: Domain d4nfxa_: 4nfx A:

Lineage for d4nfxa_ (4nfx A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries)

8. Domain d4nfxa_: 4nfx A: [266920]
   automated match to d3dkua_

Details for d4nfxa_

PDB Entry: 4nfx, 2.69 Å

PDB Description: structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli

PDB Compounds: (A:) Putative Nudix hydrolase ymfB

SCOPe Domain Sequences for d4nfxa_:

Sequence; same for both SEQRES and ATOM records:

>d4nfxa_ d.113.1.0 (A:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfnwpftkgvi

Timeline for d4nfxa_:

• d4nfxa_ first appeared in SCOPe 2.05
  
• d4nfxa_ appears in SCOPe 2.07
  
• d4nfxa_ appears in the current release, SCOPe 2.08