Lineage for d4nf0c_ (4nf0 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880822Species Pseudomonas aeruginosa [TaxId:208964] [196922] (4 PDB entries)
  8. 1880826Domain d4nf0c_: 4nf0 C: [266914]
    automated match to d4n6ka_
    complexed with lmr, so4

Details for d4nf0c_

PDB Entry: 4nf0 (more details), 1.85 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from pseudomonas aeruginosa pao1 (pa4616), target efi-510182, with bound l-malate
PDB Compounds: (C:) Probable c4-dicarboxylate-binding protein

SCOPe Domain Sequences for d4nf0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nf0c_ c.94.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
pvvikfshvvsddtpkgkgallfkklaeerlpgkvkvevypnstlfgdadeiealrankv
qmlatslskfepytkqlqvfdlpflfddlealkrfqkrdksrellrsmakhgiyglaywn
ngmkqlsatrelhrpddakglvfriqpssvleaqfamlgatakqlsyaetlkamqagsvq
gtentwsnlagqkidsvqpyitetnhgalsymlitssafwtgipyqtrtelesivdevtl
vvnkeaealnqkerehllaagksrlvslsaeeheawrnamkplwknyeaqi

SCOPe Domain Coordinates for d4nf0c_:

Click to download the PDB-style file with coordinates for d4nf0c_.
(The format of our PDB-style files is described here.)

Timeline for d4nf0c_: