Lineage for d4nf0b_ (4nf0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916002Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)
  8. 2916005Domain d4nf0b_: 4nf0 B: [266913]
    automated match to d4n6ka_
    complexed with lmr, so4

Details for d4nf0b_

PDB Entry: 4nf0 (more details), 1.85 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from pseudomonas aeruginosa pao1 (pa4616), target efi-510182, with bound l-malate
PDB Compounds: (B:) Probable c4-dicarboxylate-binding protein

SCOPe Domain Sequences for d4nf0b_:

Sequence, based on SEQRES records: (download)

>d4nf0b_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
pvvikfshvvsddtpkgkgallfkklaeerlpgkvkvevypnstlfgdadeiealrankv
qmlatslskfepytkqlqvfdlpflfddlealkrfqkrdksrellrsmakhgiyglaywn
ngmkqlsatrelhrpddakglvfriqpssvleaqfamlgatakqlsyaetlkamqagsvq
gtentwsnlagqkidsvqpyitetnhgalsymlitssafwtgipyqtrtelesivdevtl
vvnkeaealnqkerehllaagksrlvslsaeeheawrnamkplwknyeaqi

Sequence, based on observed residues (ATOM records): (download)

>d4nf0b_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
pvvikfshvvsddtpkgkgallfvevypnstlfgdadeiealrankvqmlatslskfepy
tkqlqvfdlpflfddlealkrfqkrdksrellrsmakhgiyglaywnngmkqlsatrelh
rpddakglvfriqpssvleaqfamlgatakqlsyaetlkamqagsvqgtentwsnlagqk
idsvqpyitetnhgalsymlitssafwtgrtelesivdevtlvvnkeaealnqkerehll
aagksrlvslsaeeheawrnamkplwknyeaqi

SCOPe Domain Coordinates for d4nf0b_:

Click to download the PDB-style file with coordinates for d4nf0b_.
(The format of our PDB-style files is described here.)

Timeline for d4nf0b_: