SCOPe 2.08: Domain d4n8ya_: 4n8y A:

Lineage for d4n8ya_ (4n8y A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:288000] [267971] (1 PDB entry)

8. Domain d4n8ya_: 4n8y A: [266893]
   automated match to d4mija_
   complexed with ada, gtr

Details for d4n8ya_

PDB Entry: 4n8y, 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate

PDB Compounds: (A:) Putative TRAP-type C4-dicarboxylate transport system, binding periplasmic protein (DctP subunit)

SCOPe Domain Sequences for d4n8ya_:

Sequence; same for both SEQRES and ATOM records:

>d4n8ya_ c.94.1.1 (A:) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
rdfrsadvhpadyptveavkfmgkqlaaasggklgvkvfpngalgsekdtieqlkigald
mmrinssplnnfvpetvalclpfvfrdtqhmrnvldgpigdeilaamepaglvglayyds
garsiytvkapvksladlkglkirvqqsdlwvgmiqslganptpmpygevytalktglvd
aaennwpsyessrhfeaakfynitehslapevlvmskkvwdtlskedqalvrkaakdsvp
vmrklwdereqasrkaveaagvqvvtvankqefvdamkpvyqkfagdeklsslvkriqdt

Timeline for d4n8ya_:

• d4n8ya_ first appeared in SCOPe 2.05
  
• d4n8ya_ appears in SCOPe 2.07