Lineage for d4n8ya_ (4n8y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914688Species Bradyrhizobium sp. [TaxId:288000] [267971] (1 PDB entry)
  8. 2914689Domain d4n8ya_: 4n8y A: [266893]
    automated match to d4mija_
    complexed with ada, gtr

Details for d4n8ya_

PDB Entry: 4n8y (more details), 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate
PDB Compounds: (A:) Putative TRAP-type C4-dicarboxylate transport system, binding periplasmic protein (DctP subunit)

SCOPe Domain Sequences for d4n8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8ya_ c.94.1.1 (A:) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
rdfrsadvhpadyptveavkfmgkqlaaasggklgvkvfpngalgsekdtieqlkigald
mmrinssplnnfvpetvalclpfvfrdtqhmrnvldgpigdeilaamepaglvglayyds
garsiytvkapvksladlkglkirvqqsdlwvgmiqslganptpmpygevytalktglvd
aaennwpsyessrhfeaakfynitehslapevlvmskkvwdtlskedqalvrkaakdsvp
vmrklwdereqasrkaveaagvqvvtvankqefvdamkpvyqkfagdeklsslvkriqdt

SCOPe Domain Coordinates for d4n8ya_:

Click to download the PDB-style file with coordinates for d4n8ya_.
(The format of our PDB-style files is described here.)

Timeline for d4n8ya_: