Lineage for d4n8gc_ (4n8g C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915397Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries)
  8. 2915402Domain d4n8gc_: 4n8g C: [266891]
    Other proteins in same PDB: d4n8ga2, d4n8gb2
    automated match to d4mcoc_
    complexed with cl, dal, so4

Details for d4n8gc_

PDB Entry: 4n8g (more details), 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine
PDB Compounds: (C:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4n8gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8gc_ c.94.1.0 (C:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
attlnlsyngppdtdknavhlfasnlkrlveektdgdiqlklypnsmlgeeqermeqvin
tpslniasfaglspivpeiyvsaipflfedyeaahqffdegdywnkvedtleertgaell
gvieeggfldftnskrpisspedfeglrframdpsqvalyeafgasgtpipwtdtymalk
tnvadgqmnppmyiimgslyevqkyltlanvqysdqfliangewyddlseenrqaieaav
qeaselnredvekrvderiqfladqgmevieptedelaafrekgqpayiewltdeqgidr
awiemaledagqsdll

SCOPe Domain Coordinates for d4n8gc_:

Click to download the PDB-style file with coordinates for d4n8gc_.
(The format of our PDB-style files is described here.)

Timeline for d4n8gc_: