![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries) |
![]() | Domain d4n8gb1: 4n8g B:28-345 [266890] Other proteins in same PDB: d4n8ga2, d4n8gb2 automated match to d4mcoc_ complexed with cl, dal, so4 |
PDB Entry: 4n8g (more details), 1.5 Å
SCOPe Domain Sequences for d4n8gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8gb1 c.94.1.0 (B:28-345) automated matches {Chromohalobacter salexigens [TaxId: 290398]} attlnlsyngppdtdknavhlfasnlkrlveektdgdiqlklypnsmlgeeqermeqvin tpslniasfaglspivpeiyvsaipflfedyeaahqffdegdywnkvedtleertgaell gvieeggfldftnskrpisspedfeglrframdpsqvalyeafgasgtpipwtdtymalk tnvadgqmnppmyiimgslyevqkyltlanvqysdqfliangewyddlseenrqaieaav qeaselnredvekrvderiqfladqgmevieptedelaafrekgqpayiewltdeqgidr awiemaledagqsdllan
Timeline for d4n8gb1:
![]() Domains from other chains: (mouse over for more information) d4n8ga1, d4n8ga2, d4n8gc_, d4n8gd_ |