SCOPe 2.06: Domain d4n7ua1: 4n7u A:298-482

Lineage for d4n7ua1 (4n7u A:298-482)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)

8. Domain d4n7ua1: 4n7u A:298-482 [266882]
   Other proteins in same PDB: d4n7ua2
   automated match to d4n7ia_
   complexed with 2ja, gol

Details for d4n7ua1

PDB Entry: 4n7u, 1.46 Å

PDB Description: Crystal Structure of Intracellular B30.2 Domain of BTN3A1 in Complex with CHDMAPP

PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d4n7ua1:

Sequence; same for both SEQRES and ATOM records:

>d4n7ua1 b.29.1.0 (A:298-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvlgc
esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep
rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta
lticp

Timeline for d4n7ua1:

• d4n7ua1 first appeared in SCOPe 2.05, called d4n7ua_
  
• d4n7ua1 appears in SCOPe 2.07
  
• d4n7ua1 appears in the current release, SCOPe 2.08