SCOPe 2.05: Domain d4n4ub_: 4n4u B:

Lineage for d4n4ub_ (4n4u B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [267969] (3 PDB entries)

8. Domain d4n4ub_: 4n4u B: [266879]
   automated match to d4mnpa_
   complexed with gol

Details for d4n4ub_

PDB Entry: 4n4u, 1.57 Å

PDB Description: crystal structure of abc transporter solute binding protein bb0719 from bordetella bronchiseptica rb50, target efi-510049

PDB Compounds: (B:) Putative ABC transporter periplasmic solute-binding protein

SCOPe Domain Sequences for d4n4ub_:

Sequence; same for both SEQRES and ATOM records:

>d4n4ub_ c.94.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
twmaytfgpsenlanvqgmkrvmediekntggevkfrlrlagslpiqatditqavgngtv
rfaddgfylgnvriagilrlpmllrsqedfdkayaimkpyverdfgkqgvvvlghfsfph
qvifsarklesladikgqklrvsspeqaafvqraggipvtlggaevpsalsagtidgalt
asagggkiwgdmlkynlrlpvnyfdgfylvnkkafealspemqakmresvarqapgttaq
iakeegevtdalrqkgmvivpstpameqaatdlvsgywedwareqgpeavqalaevrkal
gr

Timeline for d4n4ub_:

• d4n4ub_ is new in SCOPe 2.05-stable
  
• d4n4ub_ appears in SCOPe 2.06
  
• d4n4ub_ appears in the current release, SCOPe 2.08