Lineage for d4n45a2 (4n45 A:270-392)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917549Species Clostridium acetobutylicum [TaxId:863638] [260180] (4 PDB entries)
  8. 2917551Domain d4n45a2: 4n45 A:270-392 [266871]
    automated match to d4n46b2

Details for d4n45a2

PDB Entry: 4n45 (more details), 1.6 Å

PDB Description: crystal structure of reduced form of thiolase from clostridium acetobutylicum
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4n45a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n45a2 c.95.1.0 (A:270-392) automated matches {Clostridium acetobutylicum [TaxId: 863638]}
kplakivsygsagvdpaimgygpfyatkaaiekagwtvdeldliesneafaaqslavakd
lkfdmnkvnvnggaialghpigasgarilvtlvhamqkrdakkglatlsigggqgtaill
ekc

SCOPe Domain Coordinates for d4n45a2:

Click to download the PDB-style file with coordinates for d4n45a2.
(The format of our PDB-style files is described here.)

Timeline for d4n45a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n45a1