| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.27: G protein-binding domain [103652] (2 families) ![]() |
| Family h.1.27.2: Rabaptin-5 [118367] (2 proteins) |
| Protein automated matches [257967] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [257968] (2 PDB entries) |
| Domain d4n3yc_: 4n3y C: [266869] automated match to d1x79b_ |
PDB Entry: 4n3y (more details), 2.2 Å
SCOPe Domain Sequences for d4n3yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n3yc_ h.1.27.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille
elqqglsqakrdvqeqmavlmqs
Timeline for d4n3yc_: