SCOPe 2.06: Domain d4n1bc_: 4n1b C:

Lineage for d4n1bc_ (4n1b C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (11 PDB entries)

8. Domain d4n1bc_: 4n1b C: [266867]
   automated match to d4in4c_
   complexed with 2fs, act

Details for d4n1bc_

PDB Entry: 4n1b, 2.55 Å

PDB Description: structure of keap1 kelch domain with(1s,2r)-2-[(1s)-1-[(1-oxo-2,3- dihydro-1h-isoindol-2-yl)methyl]-1,2,3,4-tetrahydroisoquinoline-2- carbonyl]cyclohexane-1-carboxylic acid

PDB Compounds: (C:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4n1bc_:

Sequence; same for both SEQRES and ATOM records:

>d4n1bc_ b.68.11.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtle

Timeline for d4n1bc_:

• d4n1bc_ first appeared in SCOPe 2.05
  
• d4n1bc_ appears in SCOPe 2.07
  
• d4n1bc_ appears in the current release, SCOPe 2.08