Lineage for d4n15a_ (4n15 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163556Species Burkholderia ambifaria [TaxId:339670] [267965] (3 PDB entries)
  8. 2163557Domain d4n15a_: 4n15 A: [266863]
    automated match to d4p47a_
    complexed with bdp, mg

Details for d4n15a_

PDB Entry: 4n15 (more details), 1.65 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4n15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n15a_ c.94.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 339670]}
rvfrsadvhgdsfptnmavkfmgdelskltggkdsikvfgnsalgsekdtvdqvrigaid
marvngasfneivpeslipsfpflfrdvdhfrkamygpagqkildafaakgmialtfyes
garsiyakrpvrtpadmkglkvrvqpsdlmvdeiramggtptpmpfaevytglktglvda
aennlpsyeetkhfevapdysetqhamtpevlvfskkiwdtlspqeqaairkaaadsvpy
yqklwtareasaqqavtkgganilpaaqvdraafvkamqplwtkyektpqmkqivdeiea
t

SCOPe Domain Coordinates for d4n15a_:

Click to download the PDB-style file with coordinates for d4n15a_.
(The format of our PDB-style files is described here.)

Timeline for d4n15a_: