Lineage for d4mzta1 (4mzt A:2-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784335Protein automated matches [228538] (6 species)
    not a true protein
  7. 2784362Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries)
  8. 2784368Domain d4mzta1: 4mzt A:2-113 [266860]
    Other proteins in same PDB: d4mzta2, d4mztb2
    automated match to d2mf2a_

Details for d4mzta1

PDB Entry: 4mzt (more details), 2.3 Å

PDB Description: MazF from S. aureus crystal form II, C2221, 2.3 A
PDB Compounds: (A:) MazF mRNA interferase

SCOPe Domain Sequences for d4mzta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzta1 b.34.6.2 (A:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

SCOPe Domain Coordinates for d4mzta1:

Click to download the PDB-style file with coordinates for d4mzta1.
(The format of our PDB-style files is described here.)

Timeline for d4mzta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mzta2