| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
| Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
| Protein automated matches [228538] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries) |
| Domain d4mzpd1: 4mzp D:2-113 [266855] Other proteins in same PDB: d4mzpa2, d4mzpb2, d4mzpc2, d4mzpd2, d4mzpe2, d4mzpf2, d4mzpg2, d4mzph2 automated match to d2mf2a_ |
PDB Entry: 4mzp (more details), 2.7 Å
SCOPe Domain Sequences for d4mzpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mzpd1 b.34.6.2 (D:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
Timeline for d4mzpd1: