Lineage for d4mzpc_ (4mzp C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784601Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 1784634Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 1784654Protein automated matches [228538] (5 species)
    not a true protein
  7. 1784668Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries)
  8. 1784678Domain d4mzpc_: 4mzp C: [266854]
    automated match to d2mf2a_

Details for d4mzpc_

PDB Entry: 4mzp (more details), 2.7 Å

PDB Description: MazF from S. aureus crystal form III, C2221, 2.7 A
PDB Compounds: (C:) MazF mRNA interferase

SCOPe Domain Sequences for d4mzpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzpc_ b.34.6.2 (C:) automated matches {Staphylococcus aureus [TaxId: 158879]}
pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

SCOPe Domain Coordinates for d4mzpc_:

Click to download the PDB-style file with coordinates for d4mzpc_.
(The format of our PDB-style files is described here.)

Timeline for d4mzpc_: