SCOPe 2.08: Domain d4mzpa1: 4mzp A:2-114

Lineage for d4mzpa1 (4mzp A:2-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries)

8. Domain d4mzpa1: 4mzp A:2-114 [266852]
   Other proteins in same PDB: d4mzpa2, d4mzpb2, d4mzpc2, d4mzpd2, d4mzpe2, d4mzpf2, d4mzpg2, d4mzph2
   automated match to d2mf2a_

Details for d4mzpa1

PDB Entry: 4mzp, 2.7 Å

PDB Description: MazF from S. aureus crystal form III, C2221, 2.7 A

PDB Compounds: (A:) MazF mRNA interferase

SCOPe Domain Sequences for d4mzpa1:

Sequence; same for both SEQRES and ATOM records:

>d4mzpa1 b.34.6.2 (A:2-114) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglna

Timeline for d4mzpa1:

• d4mzpa1 first appeared in SCOPe 2.05, called d4mzpa_
  
• d4mzpa1 appears in SCOPe 2.07