SCOPe 2.07: Domain d4mwdb2: 4mwd B:607-767

Lineage for d4mwdb2 (4mwd B:607-767)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (12 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)

8. Domain d4mwdb2: 4mwd B:607-767 [266832]
   Other proteins in same PDB: d4mwda1, d4mwdb1, d4mwdb3
   automated match to d4mvyb1
   protein/RNA complex; complexed with 43e, acp, dms, gol, met, so4

Details for d4mwdb2

PDB Entry: 4mwd, 2.25 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea (Chem 1433) and ATP analog AMPPCP

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mwdb2:

Sequence; same for both SEQRES and ATOM records:

>d4mwdb2 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d4mwdb2:

• d4mwdb2 first appeared in SCOPe 2.05
  
• d4mwdb2 appears in SCOPe 2.06