Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (41 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries) |
Domain d4mwda1: 4mwd A:238-606 [266829] Other proteins in same PDB: d4mwda2, d4mwdb2 automated match to d4mvyb2 protein/RNA complex; complexed with 43e, acp, dms, gol, met, so4 |
PDB Entry: 4mwd (more details), 2.25 Å
SCOPe Domain Sequences for d4mwda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mwda1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn miarlngel
Timeline for d4mwda1: