Lineage for d4mwda1 (4mwd A:238-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106258Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)
  8. 2106261Domain d4mwda1: 4mwd A:238-606 [266829]
    Other proteins in same PDB: d4mwda2, d4mwdb2, d4mwdb3
    automated match to d4mvyb2
    protein/RNA complex; complexed with 43e, acp, dms, gol, met, so4

Details for d4mwda1

PDB Entry: 4mwd (more details), 2.25 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea (Chem 1433) and ATP analog AMPPCP
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mwda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwda1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

SCOPe Domain Coordinates for d4mwda1:

Click to download the PDB-style file with coordinates for d4mwda1.
(The format of our PDB-style files is described here.)

Timeline for d4mwda1: