Lineage for d4mwba2 (4mwb A:607-768)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991955Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)
  8. 1991960Domain d4mwba2: 4mwb A:607-768 [266822]
    Other proteins in same PDB: d4mwba1, d4mwbb1, d4mwbb3
    automated match to d4mvyb1
    protein/RNA complex; complexed with 2ek, dms, gol, met, so4

Details for d4mwba2

PDB Entry: 4mwb (more details), 2.31 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-(3-{[(2,5-dichlorothiophen-3-yl)methyl]amino}propyl)-3-thiophen-3-ylurea (Chem 1509)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mwba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwba2 a.27.1.0 (A:607-768) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

SCOPe Domain Coordinates for d4mwba2:

Click to download the PDB-style file with coordinates for d4mwba2.
(The format of our PDB-style files is described here.)

Timeline for d4mwba2: