| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
| Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
| Protein automated matches [226872] (13 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries) |
| Domain d4mw7b2: 4mw7 B:607-767 [266816] Other proteins in same PDB: d4mw7a1, d4mw7b1, d4mw7b3 automated match to d4mvyb1 protein/RNA complex; complexed with 2ef, dms, gol, met, so4 |
PDB Entry: 4mw7 (more details), 2.75 Å
SCOPe Domain Sequences for d4mw7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mw7b2 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d4mw7b2: