Lineage for d4mw5b1 (4mw5 B:607-767)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319325Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)
  8. 2319335Domain d4mw5b1: 4mw5 B:607-767 [266807]
    Other proteins in same PDB: d4mw5a1, d4mw5b2, d4mw5b3
    automated match to d1rqga1
    protein/RNA complex; complexed with 415, dms, gol, met, so4

Details for d4mw5b1

PDB Entry: 4mw5 (more details), 2.35 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3-chloro-5-methoxybenzyl)amino]propyl}-3-phenylurea (Chem 1415)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mw5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mw5b1 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d4mw5b1:

Click to download the PDB-style file with coordinates for d4mw5b1.
(The format of our PDB-style files is described here.)

Timeline for d4mw5b1: