| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
| Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
| Protein automated matches [226872] (8 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries) |
| Domain d4mw5b1: 4mw5 B:607-767 [266807] Other proteins in same PDB: d4mw5a1, d4mw5b2 automated match to d1rqga1 protein/RNA complex; complexed with 415, dms, gol, met, so4 |
PDB Entry: 4mw5 (more details), 2.35 Å
SCOPe Domain Sequences for d4mw5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mw5b1 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d4mw5b1: