Lineage for d4mw0b2 (4mw0 B:237-373,B:387-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106258Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)
  8. 2106260Domain d4mw0b2: 4mw0 B:237-373,B:387-606 [266792]
    Other proteins in same PDB: d4mw0a2, d4mw0b1, d4mw0b3
    automated match to d3tunb1
    protein/RNA complex; complexed with 392, dms, gol, met

Details for d4mw0b2

PDB Entry: 4mw0 (more details), 2.2 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-(2-hydroxyphenyl)urea (Chem 1392)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mw0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mw0b2 c.26.1.0 (B:237-373,B:387-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpXckvslesghvvtwvseenymfrlsafrerllewyhanpgciv
pefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnyltgsrlr
vdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkivahgww
tkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngel

SCOPe Domain Coordinates for d4mw0b2:

Click to download the PDB-style file with coordinates for d4mw0b2.
(The format of our PDB-style files is described here.)

Timeline for d4mw0b2: