SCOPe 2.05: Domain d4mvxb1: 4mvx B:607-767

Lineage for d4mvxb1 (4mvx B:607-767)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (8 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)

8. Domain d4mvxb1: 4mvx B:607-767 [266783]
   Other proteins in same PDB: d4mvxa1, d4mvxb2
   automated match to d1rqga1
   protein/RNA complex; complexed with c13, dms, gol, met

Details for d4mvxb1

PDB Entry: 4mvx, 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-phenylurea (Chem 1356)

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvxb1:

Sequence; same for both SEQRES and ATOM records:

>d4mvxb1 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d4mvxb1:

• d4mvxb1 is new in SCOPe 2.05-stable
  
• d4mvxb1 appears in SCOPe 2.06
  
• d4mvxb1 appears in the current release, SCOPe 2.08