SCOPe 2.07: Domain d4mvxa2: 4mvx A:607-768

Lineage for d4mvxa2 (4mvx A:607-768)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)

8. Domain d4mvxa2: 4mvx A:607-768 [266782]
   Other proteins in same PDB: d4mvxa1, d4mvxb2, d4mvxb3
   automated match to d4mvyb1
   protein/RNA complex; complexed with c13, dms, gol, met

Details for d4mvxa2

PDB Entry: 4mvx, 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-phenylurea (Chem 1356)

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvxa2:

Sequence; same for both SEQRES and ATOM records:

>d4mvxa2 a.27.1.0 (A:607-768) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

Timeline for d4mvxa2:

• d4mvxa2 first appeared in SCOPe 2.05
  
• d4mvxa2 appears in SCOPe 2.06
  
• d4mvxa2 appears in the current release, SCOPe 2.08