Lineage for d4mvxa1 (4mvx A:238-606)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469485Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)
  8. 2469506Domain d4mvxa1: 4mvx A:238-606 [266781]
    Other proteins in same PDB: d4mvxa2, d4mvxb1, d4mvxb3
    automated match to d4mvyb2
    protein/RNA complex; complexed with c13, dms, gol, met

Details for d4mvxa1

PDB Entry: 4mvx (more details), 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-phenylurea (Chem 1356)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mvxa1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

SCOPe Domain Coordinates for d4mvxa1:

Click to download the PDB-style file with coordinates for d4mvxa1.
(The format of our PDB-style files is described here.)

Timeline for d4mvxa1: