SCOPe 2.08: Domain d4mvxa1: 4mvx A:238-606

Lineage for d4mvxa1 (4mvx A:238-606)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)

8. Domain d4mvxa1: 4mvx A:238-606 [266781]
   Other proteins in same PDB: d4mvxa2, d4mvxb1, d4mvxb3
   automated match to d4mvyb2
   protein/RNA complex; complexed with c13, dms, gol, met

Details for d4mvxa1

PDB Entry: 4mvx, 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-phenylurea (Chem 1356)

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvxa1:

Sequence; same for both SEQRES and ATOM records:

>d4mvxa1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

Timeline for d4mvxa1:

• d4mvxa1 first appeared in SCOPe 2.05
  
• d4mvxa1 appears in SCOPe 2.07