SCOPe 2.08: Domain d4mtrb_: 4mtr B:

Lineage for d4mtrb_ (4mtr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [259805] (4 PDB entries)

8. Domain d4mtrb_: 4mtr B: [266776]
   automated match to d4mtsa_
   complexed with edo, zn

Details for d4mtrb_

PDB Entry: 4mtr, 1.83 Å

PDB Description: zn-bound gloa2

PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d4mtrb_:

Sequence, based on SEQRES records:

>d4mtrb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk
veliqkg

Sequence, based on observed residues (ATOM records):

>d4mtrb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtrviafledpdgykveliqkg

Timeline for d4mtrb_:

• d4mtrb_ first appeared in SCOPe 2.05
  
• d4mtrb_ appears in SCOPe 2.07