Lineage for d4mtrb_ (4mtr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942990Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [259805] (4 PDB entries)
  8. 2942994Domain d4mtrb_: 4mtr B: [266776]
    automated match to d4mtsa_
    complexed with edo, zn

Details for d4mtrb_

PDB Entry: 4mtr (more details), 1.83 Å

PDB Description: zn-bound gloa2
PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d4mtrb_:

Sequence, based on SEQRES records: (download)

>d4mtrb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk
veliqkg

Sequence, based on observed residues (ATOM records): (download)

>d4mtrb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtrviafledpdgykveliqkg

SCOPe Domain Coordinates for d4mtrb_:

Click to download the PDB-style file with coordinates for d4mtrb_.
(The format of our PDB-style files is described here.)

Timeline for d4mtrb_: