Lineage for d4mtqb_ (4mtq B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1901256Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1901257Protein automated matches [190239] (18 species)
    not a true protein
  7. 1901317Species Pseudomonas aeruginosa [TaxId:208964] [259805] (4 PDB entries)
  8. 1901325Domain d4mtqb_: 4mtq B: [266774]
    automated match to d4mtsa_
    complexed with ni, sin

Details for d4mtqb_

PDB Entry: 4mtq (more details), 2.17 Å

PDB Description: ni-bound gloa2
PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d4mtqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mtqb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk
veliqkgt

SCOPe Domain Coordinates for d4mtqb_:

Click to download the PDB-style file with coordinates for d4mtqb_.
(The format of our PDB-style files is described here.)

Timeline for d4mtqb_: