Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (18 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [259805] (4 PDB entries) |
Domain d4mtqb_: 4mtq B: [266774] automated match to d4mtsa_ complexed with ni, sin |
PDB Entry: 4mtq (more details), 2.17 Å
SCOPe Domain Sequences for d4mtqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mtqb_ d.32.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk veliqkgt
Timeline for d4mtqb_: