Lineage for d4ms0a_ (4ms0 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753715Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1753716Protein automated matches [190983] (6 species)
    not a true protein
  7. 1753717Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)
  8. 1753815Domain d4ms0a_: 4ms0 A: [266757]
    automated match to d4lm1a_
    complexed with 2zx, ni

Details for d4ms0a_

PDB Entry: 4ms0 (more details), 1.79 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT0443 (6-chloropyrimidine-2,4-diamine)
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4ms0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ms0a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agtsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvt
kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
pptepllkacrdnlsqwekvirgeetatwi

SCOPe Domain Coordinates for d4ms0a_:

Click to download the PDB-style file with coordinates for d4ms0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ms0a_: