Lineage for d4mmza4 (4mmz A:738-954)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770079Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 1770104Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 1770105Protein automated matches [233857] (1 species)
    not a true protein
  7. 1770106Species Human (Homo sapiens) [TaxId:9606] [233858] (7 PDB entries)
  8. 1770121Domain d4mmza4: 4mmz A:738-954 [266750]
    Other proteins in same PDB: d4mmza1, d4mmzc_
    automated match to d1m1xa3
    complexed with cl, gol, mn, na, nag

Details for d4mmza4

PDB Entry: 4mmz (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to an antagonistic tenth domain of fibronectin
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4mmza4:

Sequence, based on SEQRES records: (download)

>d4mmza4 b.1.15.0 (A:738-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwg

Sequence, based on observed residues (ATOM records): (download)

>d4mmza4 b.1.15.0 (A:738-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikihtlgcgvaqclkivcqvgrldr
gksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnv
twg

SCOPe Domain Coordinates for d4mmza4:

Click to download the PDB-style file with coordinates for d4mmza4.
(The format of our PDB-style files is described here.)

Timeline for d4mmza4: