Lineage for d4mmza1 (4mmz A:1-438)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066399Protein automated matches [254690] (1 species)
    not a true protein
  7. 2066400Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2066407Domain d4mmza1: 4mmz A:1-438 [266747]
    Other proteins in same PDB: d4mmza2, d4mmza3, d4mmza4, d4mmzc_
    automated match to d1m1xa4
    complexed with cl, gol, mn, na, nag

Details for d4mmza1

PDB Entry: 4mmz (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to an antagonistic tenth domain of fibronectin
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4mmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mmza1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d4mmza1:

Click to download the PDB-style file with coordinates for d4mmza1.
(The format of our PDB-style files is described here.)

Timeline for d4mmza1: