SCOPe 2.08: Domain d4mmya4: 4mmy A:738-956

Lineage for d4mmya4 (4mmy A:738-956)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)

8. Domain d4mmya4: 4mmy A:738-956 [266746]
   Other proteins in same PDB: d4mmya1, d4mmyc_
   automated match to d1m1xa3
   complexed with mn, nag

Details for d4mmya4

PDB Entry: 4mmy, 3.18 Å

PDB Description: integrin alphavbeta3 ectodomain bound to the tenth domain of fibronectin with the iakgdwnd motif

PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4mmya4:

Sequence, based on SEQRES records:

>d4mmya4 b.1.15.0 (A:738-956) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiq

Sequence, based on observed residues (ATOM records):

>d4mmya4 b.1.15.0 (A:738-956) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikidihtlgcgvaqclkivcqvgrl
drgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvtt
nvtwgiq

Timeline for d4mmya4:

• d4mmya4 first appeared in SCOPe 2.05
  
• d4mmya4 appears in SCOPe 2.07