Lineage for d4mija1 (4mij A:31-330)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914672Protein TRAP dicarboxylate transporter [267666] (2 species)
  7. 2914673Species Polaromonas [TaxId:296591] [267752] (1 PDB entry)
  8. 2914674Domain d4mija1: 4mij A:31-330 [266737]
    Other proteins in same PDB: d4mija2
    complexed with ada, cl, edo, gtr
    has additional insertions and/or extensions that are not grouped together

Details for d4mija1

PDB Entry: 4mij (more details), 1.1 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4mija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mija1 c.94.1.1 (A:31-330) TRAP dicarboxylate transporter {Polaromonas [TaxId: 296591]}
tefrsadthnaddyptvaavkymgellekksggkhkikvfnkqalgseketidqvkigal
dftrvnvgpmnaicpltqvptmpflfssiahmrksldgpvgdeilkscesagfiglafyd
sgarsiyakkpirtvadakglkirvqqsdlwvalvsamganatpmpygevytglktglid
aaennipsfdtakhveavkvysktehsmapeilvmskiiydklpkaeqdmiraaakesva
ferqkwdeqeakslanvkaagaeivevdkksfqavmgpvydkfmttpdmkrlvkavqdtk

SCOPe Domain Coordinates for d4mija1:

Click to download the PDB-style file with coordinates for d4mija1.
(The format of our PDB-style files is described here.)

Timeline for d4mija1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mija2