SCOPe 2.08: Domain d4mija1: 4mij A:31-330

Lineage for d4mija1 (4mij A:31-330)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein TRAP dicarboxylate transporter [267666] (2 species)

7. Species Polaromonas [TaxId:296591] [267752] (1 PDB entry)

8. Domain d4mija1: 4mij A:31-330 [266737]
   Other proteins in same PDB: d4mija2
   complexed with ada, cl, edo, gtr
   has additional insertions and/or extensions that are not grouped together

Details for d4mija1

PDB Entry: 4mij, 1.1 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21

PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4mija1:

Sequence; same for both SEQRES and ATOM records:

>d4mija1 c.94.1.1 (A:31-330) TRAP dicarboxylate transporter {Polaromonas [TaxId: 296591]}
tefrsadthnaddyptvaavkymgellekksggkhkikvfnkqalgseketidqvkigal
dftrvnvgpmnaicpltqvptmpflfssiahmrksldgpvgdeilkscesagfiglafyd
sgarsiyakkpirtvadakglkirvqqsdlwvalvsamganatpmpygevytglktglid
aaennipsfdtakhveavkvysktehsmapeilvmskiiydklpkaeqdmiraaakesva
ferqkwdeqeakslanvkaagaeivevdkksfqavmgpvydkfmttpdmkrlvkavqdtk

Timeline for d4mija1:

• d4mija1 first appeared in SCOPe 2.05, called d4mija_
  
• d4mija1 appears in SCOPe 2.07